PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 338aa    MW: 38539.7 Da    PI: 7.4008
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930343.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.51.3e-49221472128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+ee++ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t sgyWkatg d+ + s++
  XP_010930343.1  22 MPGFRFHPTEEEIIEFYLRRKVEGKHFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTISGYWKATGADRMIRSEN 115
                     79***************************.89***************8778899***************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +glkktLvfy+g+apkg +++W+mheyrl
  XP_010930343.1 116 SRPIGLKKTLVFYSGKAPKGIRSSWIMHEYRL 147
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5521168IPR003441NAC domain
PROSITE profilePS5100555.53421168IPR003441NAC domain
PfamPF023651.6E-2423147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAIPAAMSGE DEKDEHEHDL VMPGFRFHPT EEEIIEFYLR RKVEGKHFNV ELITFLDLYR  60
YDPWELPALA AIGEKEWFFY VPRDRKYRNG DRPNRVTISG YWKATGADRM IRSENSRPIG  120
LKKTLVFYSG KAPKGIRSSW IMHEYRLPQS ETDRYHKTEI SLCRVYKRGG IEDHLPVMHK  180
PSSKPTRPDK KYKRFYQPSS LFTALAGDSS SSEIEKIHEG GVYSSTNNIS VYSAIPPVSN  240
MTALLKEDGT SLNSSNTLIP TSTLLPSATS SMAIADEFNK MVGCHQGYFN QTSQFITMPS  300
QPQLLPLDGL PMSLATISDN LWEWNQIHEA GKDLTSFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-5591688168NAC domain-containing protein 19
3swp_C2e-5591688168NAC domain-containing protein 19
3swp_B2e-5591688168NAC domain-containing protein 19
3swp_A2e-5591688168NAC domain-containing protein 19
3swm_D2e-5591688168NAC domain-containing protein 19
3swm_C2e-5591688168NAC domain-containing protein 19
3swm_B2e-5591688168NAC domain-containing protein 19
3swm_A2e-5591688168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930341.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_010930343.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLM0SGN51e-142M0SGN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P21690_0011e-142(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-103NAC domain containing protein 35